PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00155389001
Common NameGSBRNA2T00155389001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 336aa    MW: 37184.2 Da    PI: 9.6478
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00155389001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1231e-3880140262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++++++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg++rknk+ss
  GSBRNA2T00155389001  80 PQEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSS 140
                          6899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3079138IPR003851Zinc finger, Dof-type
PfamPF027017.9E-3382138IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.70584138IPR003851Zinc finger, Dof-type
PROSITE patternPS01361086122IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MKLISNFFMD ATKWTQGFQE MINVKPMDQM ISNTNNSTSQ QQQPTFIATT SRPNATVANG  60
GSGGNNNNTA TTMETRKARP QEKVNCPRCN STNTKFCYYN NYSLTQPRYF CKGCRRYWTE  120
GGSLRNVPVG GSSRKNKRSS TPLASHSNPK LPDLNPPILF SSQIPNKSSK DLNLLSFPVM  180
QDHHHGMSQF LHMPKIENNN TSSSIYASSS PVSALELLRS NGVSSRGMNT FLPGQMMDSN  240
SVLYSSLGFP TMVDYKQSNN NLSFSIDHHQ GIGNNTINSN QRAEDNNHAD DMNGASRVLF  300
PFSDMKELSS TTQDKSHGNN TYWSGMFTNT GGSSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.144941e-58seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00155389001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794810.0JN979481.1 Brassica rapa subsp. pekinensis auxin response factor 18-1 (ARF18-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013711665.10.0PREDICTED: dof zinc finger protein DOF3.7 isoform X1
SwissprotQ433850.0DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A078C6B90.0A0A078C6B9_BRANA; BnaC08g31700D protein
STRINGBra007632.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25282673
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.40.0Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]